PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_32635_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 173aa    MW: 20247.7 Da    PI: 10.6112
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_32635_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding612.4e-193986148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         rg+WT eEd++l++ ++ +G++ WktIa + g++R++k+c++rw +yl
  cra_locus_32635_iso_1_len_517_ver_3 39 RGAWTDEEDQRLAETIEIFGPKKWKTIAVKAGLNRCGKSCRLRWMNYL 86
                                         89********************************************97 PP

2Myb_DNA-binding51.13e-1692137148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
  cra_locus_32635_iso_1_len_517_ver_3  92 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 137
                                          78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.8413490IPR017930Myb domain
SuperFamilySSF466891.5E-2937133IPR009057Homeodomain-like
SMARTSM007175.1E-143888IPR001005SANT/Myb domain
PfamPF002496.9E-173986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-244093IPR009057Homeodomain-like
CDDcd001677.15E-94186No hitNo description
SMARTSM007171.9E-1591139IPR001005SANT/Myb domain
PROSITE profilePS5129420.66591141IPR017930Myb domain
PfamPF002491.3E-1492137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2594141IPR009057Homeodomain-like
CDDcd001673.46E-996137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
XERNQEKAMA AMNDQSSKEE VREAIGAAKN QKGKKEVNRG AWTDEEDQRL AETIEIFGPK  60
KWKTIAVKAG LNRCGKSCRL RWMNYLRPNI KRGNISDQEE DLILRLHKLL GNRWSLIAGR  120
LPGRTDNEIK NYWNSHLSKK VEEQGKNRQE EEGHHGRRRK RRKMNAVEVK EEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-323614124128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155163GRRRKRRKM
2156162RRRKRRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004303466.12e-69PREDICTED: transcription factor MYB114-like
SwissprotP102905e-51MYBC_MAIZE; Anthocyanin regulatory C1 protein
SwissprotQ9SEI02e-51WER_ARATH; Transcription factor WER
TrEMBLA0A068TNE52e-73A0A068TNE5_COFCA; Uncharacterized protein
STRINGPOPTR_0006s23780.12e-66(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154